AV46165

Anti-STIP1 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-HOP, Anti-IEF-SSP-3521, Anti-P60, Anti-STI1, Anti-STI1L, Anti-Stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 63 kDa
• 종 반응성: bovine, rat, horse, mouse, rabbit, human, dog
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_006810
• UniProt 수납 번호: P31948
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... STIP1(10963)

설명

일반 설명

Stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) (STIP1, HOP, IEF-SSP-3521, STI1, STI1L, P60) is a co-chaperone that regulates and assists heat shock proteins (major chaperones). STIP1 links the chaperones Hsp70 and Hsp90 together to facilitate their function. HOP ensures the productive folding of substrate proteins by controlling the chaperone activities of HSP70 and HSP90.

특이성

Anti-STIP1 (AB2) polyclonal antibody reacts with bovine, human, mouse, rat, and canine stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) proteins..

면역원

Synthetic peptide directed towards the C terminal region of human STIP1

애플리케이션

Anti-STIP1 (AB2) polyclonal antibody is used to tag stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) in the management of protein refolding by heat shock proteins such as Hsp70 and Hsp90.

생화학적/생리학적 작용

STIP1 mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).

서열

Synthetic peptide located within the following region: YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable