추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
55 kDa
종 반응성
rabbit, rat, human, bovine, horse, mouse, dog, guinea pig
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... TBX15(6913)
일반 설명
TBX15 codes for T-box transcription factor that regulates embryonic development. TBX15 mutations have been linked to Cousin syndrome.
Rabbit anti-TBX15 antibody recognizes human, mouse, rat, and canine TBX15.
The previously assigned protein identifier Q5JT54 has been merged into Q96SF7. Full details can be found on the UniProt database.
Rabbit anti-TBX15 antibody recognizes human, mouse, rat, and canine TBX15.
The previously assigned protein identifier Q5JT54 has been merged into Q96SF7. Full details can be found on the UniProt database.
면역원
Synthetic peptide directed towards the C terminal region of human TBX15
애플리케이션
Rabbit anti-TBX15 antibody is suitable for western blot applications at a concentration of 1.25μg/ml and for IHC applications (using paraffin-embedded tissues) at 4-8μg/ml.
생화학적/생리학적 작용
TBX15 is a probable transcriptional regulator involved in developmental processes.
서열
Synthetic peptide located within the following region: YGYNFPTSPRLAASPEKLSASQSTLLCSSPSNGAFGERQYLPSGMEHSMH
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Esra Dikoglu et al.
American journal of medical genetics. Part A, 161A(12), 3161-3165 (2013-09-17)
Cousin syndrome, also called pelviscapular dysplasia (OMIM 260660), is characterized by short stature, craniofacial dysmorphism, and multiple skeletal anomalies. Following its description in two sibs in 1982, no new cases have been observed until the observation of two unrelated cases
Ekkehart Lausch et al.
American journal of human genetics, 83(5), 649-655 (2008-12-11)
Members of the evolutionarily conserved T-box family of transcription factors are important players in developmental processes that include mesoderm formation and patterning and organogenesis both in vertebrates and invertebrates. The importance of T-box genes for human development is illustrated by
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.