콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV48046

Sigma-Aldrich

Anti-YWHAZ antibody produced in rabbit

IgG fraction of antiserum

동의어(들):

Anti-KCIP-1, Anti-MGC111427, Anti-MGC126532, Anti-MGC138156, Anti-Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

28 kDa

종 반응성

rat, mouse, horse, rabbit, human, guinea pig, dog, bovine, sheep

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... YWHAZ(7534)

일반 설명

Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta (YWHAZ) is a member of the 14-3-3 family that regulates signal transduction. Increased expression of YWHAZ has been linked to the growth and metastasis of gastric carcinoma. YWHAZ amplification is associated with breast cancer recurrence and chemotherapy resistance.
Rabbit Anti-YWHAZ antibody recognizes chicken, bovine, pig, human, mouse, rat, and canine YWHAZ.

면역원

Synthetic peptide directed towards the C terminal region of human YWHAZ

애플리케이션

Rabbit Anti-YWHAZ antibody is suitable for western blot applications at a concentration of 5μg/ml.

생화학적/생리학적 작용

YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity.This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Two transcript variants differing in the 5′ UTR, but encoding the same protein, have been identified for this gene.

서열

Synthetic peptide located within the following region: AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Yang Li et al.
Nature medicine, 16(2), 214-218 (2010-01-26)
Adjuvant chemotherapy for breast cancer after surgery has effectively lowered metastatic recurrence rates. However, a considerable proportion of women suffer recurrent cancer at distant metastatic sites despite adjuvant treatment. Identification of the genes crucial for tumor response to specific chemotherapy
Y Nishimura et al.
British journal of cancer, 108(6), 1324-1331 (2013-02-21)
Several studies have demonstrated that YWHAZ (14-3-3ζ), included in the 14-3-3 family of proteins, has been implicated in the initiation and progression of cancers. We tested whether YWHAZ acted as a cancer-promoting gene through its activation/overexpression in gastric cancer (GC).

문서

Phase I biotransformation reactions increase drug compound polarity, mainly occurring in hepatic circulation.

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.