AV48116

Anti-SLC14A1 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-FLJ33745, Anti-FLJ41687, Anti-HUT11, Anti-HsT1341, Anti-JK, Anti-RACH1, Anti-Solute carrier family 14 (urea transporter), member 1 (Kidd blood group), Anti-UT-B1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 42 kDa
• 종 반응성: human
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_001122060
• UniProt 수납 번호: Q13336
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SLC14A1(6563)

설명

일반 설명

SLC14A1 codes for a protein that belongs to the solute carrier family. It facilitates the transport of urea in red blood cells and also forms the basis of the Kidd blood grouping system. SLC14A1 has been identified as a susceptibility locus for bladder cancer.
Rabbit Anti-SLC14A1 antibody recognizes human, canine, bovine, and mouse SLC14A1.

면역원

Synthetic peptide directed towards the C terminal region of human SLC14A1

애플리케이션

Rabbit Anti-SLC14A1 antibody is suitable for western blot applications at a concentration of western blot at a concentration of 0.25 μg/ml and for IHC at 4-8 μg/ml.

생화학적/생리학적 작용

SLC14A1 is a specialized low-affinity urea transporter. It mediates urea transport in erythrocytes.

서열

Synthetic peptide located within the following region: LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable