AV48247

Anti-SEP15 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-Selenoprotein 15 kDa
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 15 kDa
• 종 반응성: mouse, rat, pig, human
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_004252
• UniProt 수납 번호: O60613
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SEP15(9403)

설명

일반 설명

SEP15 is a selenoprotein that regulates the unfolded protein response. It is modulated by ER stresses. SEP15 variations have been linked to the risk of lung cancer.
Rabbit Anti-SEP15 antibody recognizes bovine, zebrafish, pig, human, mouse, rat, and canine SEP15.

면역원

Synthetic peptide directed towards the middle region of human SEP15

애플리케이션

Rabbit Anti-SEP15 antibody is suitable for western blot applications at a concentration of 1μg/ml.

생화학적/생리학적 작용

SEP15 is a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. Studies in mouse suggest that this selenoprotein may have redox function and may be involved in the quality control of protein folding. The gene that encodes the protein is localized on chromosome 1p31, a genetic locus commonly mutated or deleted in human cancers. This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3′ UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies in mouse suggest that this selenoprotein may have redox function and may be involved in the quality control of protein folding. This gene is localized on chromosome 1p31, a genetic locus commonly mutated or deleted in human cancers. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

서열

Synthetic peptide located within the following region: SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable