추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
30 kDa
종 반응성
rabbit, bovine, horse, mouse, rat, dog, goat, human, guinea pig
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... TNNT3(7140)
면역원
Synthetic peptide directed towards the N terminal region of human TNNT3
애플리케이션
Anti-TNNT3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.
생화학적/생리학적 작용
Troponin T type 3 (TNNT3) is a fast-twitch muscle protein belonging to the troponin T gene family. It forms a complex that regulates striated muscle contraction along with troponins C and I. Two isoforms of TNNT3 are present, the fetal/neonatal and the adult isoforms and a developmental switch of the isoforms occurs. Mutations in TNNT3 have been identified in distal arthrogryposis multiplex congenita type 2B and Sheldon-Hall syndrome.
서열
Synthetic peptide located within the following region: PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
P A Krakowiak et al.
American journal of medical genetics, 76(1), 93-98 (1998-03-21)
We describe the clinical characteristics of a provisionally unique form of distal arthrogryposis. The anomalies observed in affected individuals are more severe than those in distal arthrogryposis type 1 and are similar to but less dramatic than those described in
Ning Zhao et al.
European journal of medical genetics, 54(3), 351-353 (2011-03-16)
Distal arthrogryposis (DA) is a group of rare, clinically and genetically heterogeneous disorders primarily characterized by congenital contractures of the limb joints. Recently, mutations in genes encoding the fast-twitch skeletal muscle contractile myofibers complex, including troponin I2 (TNNI2), troponin T3
Tathagata Chaudhuri et al.
Journal of molecular biology, 352(1), 58-71 (2005-08-06)
In mammalian fast skeletal muscle, constitutive and alternative splicing from a single troponin T (TnT) gene produce multiple developmentally regulated and tissue specific TnT isoforms. Two exons, alpha (exon 16) and beta (exon 17), located near the 3' end of
Raymund Stefancsik et al.
Comparative and functional genomics, 4(6), 609-625 (2008-07-17)
We describe the cloning, sequencing and structure of the human fast skeletal troponin T (TNNT3) gene located on chromosome 11p15.5. The single-copy gene encodes 19 exons and 18 introns. Eleven of these exons, 1-3, 9-15 and 18, are constitutively spliced
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.