콘텐츠로 건너뛰기
Merck
모든 사진(3)

주요 문서

AV54576

Sigma-Aldrich

Anti-GCLC antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-GCS, Anti-GLCL, Anti-GLCLC, Anti-Glutamate-cysteine ligase, catalytic subunit

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

73 kDa

종 반응성

human, dog, rat, mouse, bovine, guinea pig, rabbit

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... GCLC(2729)

관련 카테고리

면역원

Synthetic peptide directed towards the N terminal region of human GCLC

애플리케이션

Anti-GCLC antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

생화학적/생리학적 작용

GCLC gene encodes the heavy catalytic subunit of the enzyme glutamate-cysteine ligase, which is the rate limiting enzyme of glutathione synthesis. Mutation at this locus is associated with hemolytic anemia due to deficiency of γ-glutamylcysteine synthetase. Polymorphism in GCLC subunit is found to be associated with sulfamethoxazole-induced hypersensitivity in HIV/AIDS patients in a study. A GAG-trinucleotide repeat polymorphism in the 5′-untranslated region of the gene is shown to lower the levles of GCL activity and GSH (glutathione), a major intracellular antioxidant. Therefore, it is associated with increased risk for lung and aerodigestive tract cancers.

서열

Synthetic peptide located within the following region: VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Yunsheng Li et al.
Molecular reproduction and development, 89(10), 443-458 (2022-08-25)
MicroRNA21 (MIR21) abundance in porcine oocytes and cumulus cells increases during in vitro maturation. The mechanism by which MIR21 regulates oocyte maturation and the effect on the developmental competence of subsequent embryos remains unclear. The objective of this study was
Sailendra N Nichenametla et al.
Molecular carcinogenesis, 52(10), 791-799 (2012-05-23)
Glutathione (GSH), the major intracellular antioxidant, protects against cancer development by detoxifying carcinogens and free radicals and strengthening the immune system. Recently, a GAG-trinucleotide repeat polymorphism in the 5'-untranslated region of the gene for the rate-limiting enzyme for GSH biosynthesis
Danxin Wang et al.
BMC medical genomics, 5, 32-32 (2012-07-25)
Sulfamethoxazole (SMX) is a commonly used antibiotic for prevention of infectious diseases associated with HIV/AIDS and immune-compromised states. SMX-induced hypersensitivity is an idiosyncratic cutaneous drug reaction with genetic components. Here, we tested association of candidate genes involved in SMX bioactivation
Christophe Butticaz et al.
Free radical biology & medicine, 50(5), 617-623 (2010-12-16)
Glutamate cysteine ligase (GCL) catalyzes the rate-limiting step in the de novo synthesis of glutathione (GSH). The catalytic subunit (GCLC) of GCL contains a GAG trinucleotide-repeat (TNR) polymorphism within the 5'-untranslated region (5'-UTR) that has been associated with various human
Kun-Ming Chen et al.
Chemical research in toxicology, 35(11), 2152-2159 (2022-10-20)
In a series of previous studies we reported that black raspberry (BRB) powder inhibits dibenzo[a,l]pyrene (DBP)-induced DNA damage, mutagenesis, and oral squamous cell carcinoma (OSCC) development in mice. In the present study, using human oral leukoplakia (MSK-Leuk1) and squamous cell

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.