추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
73 kDa
종 반응성
human, dog, rat, mouse, bovine, guinea pig, rabbit
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... GCLC(2729)
관련 카테고리
면역원
Synthetic peptide directed towards the N terminal region of human GCLC
애플리케이션
Anti-GCLC antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
생화학적/생리학적 작용
GCLC gene encodes the heavy catalytic subunit of the enzyme glutamate-cysteine ligase, which is the rate limiting enzyme of glutathione synthesis. Mutation at this locus is associated with hemolytic anemia due to deficiency of γ-glutamylcysteine synthetase. Polymorphism in GCLC subunit is found to be associated with sulfamethoxazole-induced hypersensitivity in HIV/AIDS patients in a study. A GAG-trinucleotide repeat polymorphism in the 5′-untranslated region of the gene is shown to lower the levles of GCL activity and GSH (glutathione), a major intracellular antioxidant. Therefore, it is associated with increased risk for lung and aerodigestive tract cancers.
서열
Synthetic peptide located within the following region: VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Sailendra N Nichenametla et al.
Molecular carcinogenesis, 52(10), 791-799 (2012-05-23)
Glutathione (GSH), the major intracellular antioxidant, protects against cancer development by detoxifying carcinogens and free radicals and strengthening the immune system. Recently, a GAG-trinucleotide repeat polymorphism in the 5'-untranslated region of the gene for the rate-limiting enzyme for GSH biosynthesis
Yunsheng Li et al.
Molecular reproduction and development, 89(10), 443-458 (2022-08-25)
MicroRNA21 (MIR21) abundance in porcine oocytes and cumulus cells increases during in vitro maturation. The mechanism by which MIR21 regulates oocyte maturation and the effect on the developmental competence of subsequent embryos remains unclear. The objective of this study was
Sotiria Makri et al.
In vivo (Athens, Greece), 34(4), 1811-1821 (2020-07-02)
Olive mill wastewater (OMW) is a byproduct of olive oil production. The aim of the study was to estimate the redox profile of lambs' vital organs after consumption of an OMW-supplemented feed. Twenty-four lambs received breast milk until day 15.
Kun-Ming Chen et al.
Chemical research in toxicology, 35(11), 2152-2159 (2022-10-20)
In a series of previous studies we reported that black raspberry (BRB) powder inhibits dibenzo[a,l]pyrene (DBP)-induced DNA damage, mutagenesis, and oral squamous cell carcinoma (OSCC) development in mice. In the present study, using human oral leukoplakia (MSK-Leuk1) and squamous cell
Peng Han et al.
Oxidative medicine and cellular longevity, 2017, 7612182-7612182 (2018-02-13)
Acute kidney injury (AKI) induced by ischemia-reperfusion is a critical conundrum in many clinical settings. Here, this study aimed to determine whether and how RTA-408, a novel oleanane triterpenoid, could confer protection against renal ischemia-reperfusion injury (IRI) in male mice.
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.