HPA008070

Anti-CALCRL antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-CGRP type 1 receptor, Anti-Calcitonin gene-related peptide type 1 receptor precursor, Anti-Calcitonin receptor-like receptor
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA008070
• NACRES: NA.43

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunohistochemistry: 1:50- 1:200
• 면역원 서열: EDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTA
• UniProt 수납 번호: Q16602
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CALCRL(10203)

설명

일반 설명

CALCRL (Calcitonin gene-related peptide type 1 receptor) gene is mapped to human chromosome 2q32.1 and contains 15 exons interspaced by 14 introns. Exons 1 to 3 form the non-coding region. Exons 4 through 15 comprise the coding region. The exons 8 to 14 in this region encodes seven transmembrane domains.

면역원

Calcitonin gene-related peptide type 1 receptor precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

생화학적/생리학적 작용

CALCRL (Calcitonin gene-related peptide type 1 receptor) gene encodes a class B G protein-coupled receptor (GPCR) that forms a heterodimer complex with receptor activity-modifying protein 2 (RAMP2). This complex functions as a receptor for adrenomedullin (AM). CALCRL is activated by core glycosylation after transport from endoplasmic reticulum to the cell membrane by RAMP2. CALCRL also binds to RAMP1 and functions as a CGRP receptor. Overexpression of this protein increases the sensitivity of the sphincter muscle to endogenous AM. This causes chronic relaxation of the sphincter muscle and obstructs aqueous outflow system. Polymorphism in this gene has been linked to primary angle closure glaucoma.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST71225

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)