콘텐츠로 건너뛰기
Merck
모든 사진(2)

Key Documents

HPA010860

Sigma-Aldrich

Anti-SPTLC1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-LCB 1 antibody produced in rabbit, Anti-Long chain base biosynthesis protein 1 antibody produced in rabbit, Anti-SPT 1 antibody produced in rabbit, Anti-SPT1 antibody produced in rabbit, Anti-Serine palmitoyltransferase 1 antibody produced in rabbit, Anti-Serine-palmitoyl-CoA transferase 1 antibody produced in rabbit

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

형태

buffered aqueous glycerol solution

종 반응성

human

기술

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50- 1:200

면역원 서열

KTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPR

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... SPTLC1(10558)

일반 설명

SPTLC1 (serine palmitoyltransferase, long chain base subunit 1) makes a heterodimer with SPTLC2, which forms the enzyme serine palmitoyltransferase (SPT). SPT resides in the outer membrane of endoplasmic reticulum (ER). SPTLC1 gene maps to human chromosome 9q22.2. This protein has a molecular weight of 53kDa, and is expressed in nucleus, focal adhesions as well as ER. It has multiple putative PDZ binding motifs and a transcription cofactor motif (LXXLL).

면역원

Serine palmitoyltransferase 1 recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

생화학적/생리학적 작용

Serine palmitoyltransferase (SPT) participates in sphingolipid biosynthesis by catalyzing the first step. It catalyzes the condensation of L-serine with palmitoyl-CoA. SPTLC1 (serine palmitoyltransferase, long chain base subunit 1) also resides in focal adhesions, which suggests that it either plays a role in, or is essential for maintaining the normal morphology of cell. As this protein contains the transcription cofactor motif (LXXLL), it might also act as a transcriptional co-regulator that shuttles between the nucleus and cytoplasm. Mutations in SPTLC1 are associated with hereditary sensory neuropathy type 1 (HSN1), which is characterized by length-dependent axonal degeneration. HSN1 cells show abnormalities in mitochondria and ER stress, which are the results of SPTLC1 mutations. Mutation in Ser331residue of this protein, is linked to the early-onset and severe phenotype of HSN1.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST71690

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Molecular Profile of Human Serine
Palmitoyltransferase-1 Proximate of
Chromosome 9 Disease Susceptibility Gene Cluster in Inflammatory Cancer Cell Lines
Tokunbo Y
Journal of Cancer Therapy, 5, 885-901 (2014)
Bum Chun Suh et al.
Molecular medicine reports, 9(2), 481-486 (2013-11-20)
Hereditary sensory and autonomic neuropathy type I (HSAN I) is an autosomal dominant disease characterized by prominent sensory impairment, resulting in foot ulcers or amputations and has a juvenile to adult onset. The major underlying causes of HSAN I are
Simon J Myers et al.
DNA and cell biology, 33(7), 399-407 (2014-03-29)
Mutations in serine palmitoyltransferase long chain subunit 1 (SPTLC1) cause the typical length-dependent axonal degeneration hereditary sensory neuropathy type 1 (HSN1). Transmission electron microscopy studies on SPTLC1 mutant lymphoblasts derived from patients revealed specific structural abnormalities of mitochondria. Swollen mitochondria
Jia Wei et al.
Biochimica et biophysica acta, 1791(8), 746-756 (2009-04-14)
Serine palmitoyltransferase (SPT) has been localized to the endoplasmic reticulum (ER) by subcellular fractionation and enzymatic assays, and fluorescence microscopy of epitope-tagged SPT; however, our studies have suggested that SPT subunit 1 might be present also in focal adhesions and
Annelies Rotthier et al.
Human mutation, 32(6), E2211-E2225 (2011-05-28)
Hereditary sensory and autonomic neuropathy type I (HSAN-I) is an axonal peripheral neuropathy leading to progressive distal sensory loss and severe ulcerations. Mutations in SPTLC1 and SPTLC2, encoding the two subunits of serine palmitoyltransferase (SPT), the enzyme catalyzing the first

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.