콘텐츠로 건너뛰기
Merck
모든 사진(5)

Key Documents

HPA011133

Sigma-Aldrich

Anti-LPP antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-LIM domain-containing preferred translocation partner in lipoma, Anti-Lipoma-preferred partner

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

형태

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

기술

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

면역원 서열

PSPHYMAAPSSGQIYGSGPQGYNTQPVPVSGQCPPPSTRGGMDYAYIPPPGLQPEPGYGYAPNQGRYYEGYYAAGPGYGGRNDSDPTYGQQGHPNTWKREPGY

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... LPP(4026)

일반 설명

LPP (LIM domain containing preferred translocation partner in lipoma) is a member of group 3 of LIM (Lin11, Isl-1 & Mec-3) family of proteins. It is localized to human chromosome 3q28, has 10 exons, and spans around 400kb. It has an open reading frame of 1836bp, which codes for an 80kDa protein. Its N-terminal contains a leucine zipper motif, and it has three LIM domains at its C-terminal. It is expressed by the smooth muscle cells of stomach, portal vein, aorta, bladder, ileum, corpus cavernosum and uterus. Two alternatively spliced variants are exclusively expressed in testis.

면역원

Lipoma-preferred partner recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-LPP antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

LPP (LIM domain containing preferred translocation partner in lipoma) is involved in cell-cell adhesion and cell locomotion, as in the case of epithelial cells of small intestine. Therefore, it might be implicated in the pathogenesis of celiac disease. It interacts with protein-tyrosine-phosphatase 1 B (PTP1B), and thus, might be involved in insulin signaling pathway. It is therefore, a candidate gene for polycystic ovary syndrome (PCOS). It is up-regulated in many human cancers such as, lung carcinoma, soft tissue sarcoma, and leukemia. It is a translocation partner of chromosome 12, in a subset of lipomas. LPP plays a role in cell proliferation and tumorigenesis. It amplifies the transactivational activity of PEA3 (polyoma enhancer activator 3), by acting as a co-regulatory protein at PEA3-dependent promoters.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST72480

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Rodrigo Almeida et al.
Human molecular genetics, 23(9), 2481-2489 (2013-12-18)
Using the Immunochip for genotyping, we identified 39 non-human leukocyte antigen (non-HLA) loci associated to celiac disease (CeD), an immune-mediated disease with a worldwide frequency of ∼1%. The most significant non-HLA signal mapped to the intronic region of 70 kb
Subhajit Ghosh et al.
Journal of the American Heart Association, 4(6), e001712-e001712 (2015-06-14)
Exposure of vascular smooth muscle cells (VSMCs) to excessive cyclic stretch such as in hypertension causes a shift in their phenotype. The focal adhesion protein zyxin can transduce such biomechanical stimuli to the nucleus of both endothelial cells and VSMCs
Bo Zhang et al.
PloS one, 7(10), e46370-e46370 (2012-10-12)
Previous genome-wide association study (GWAS) of polycystic ovary syndrome (PCOS) in Han Chinese population has found that SNPs in LPP gene were nominally significant in PCOS patients (P around 10E-05). Replication of the GWAS was applied to further confirm the
M M Petit et al.
Genomics, 36(1), 118-129 (1996-08-15)
A major cytogenetic subgroup of lipomas is characterized by recurrent chromosome aberrations, mainly translocations, that involve chromosome segment 12q13-q15. Multiple chromosomes have been found as the translocation partners of chromosome 12 but 3q27-q28 is preferentially involved. In previous studies, it
Thomas Gp Grunewald et al.
Translational oncology, 2(3), 107-116 (2009-08-25)
Integrating signals from the extracellular matrix through the cell surface into the nucleus is an essential feature of metazoan life. To date, many signal transducers known as shuttle proteins have been identified to act as both a cytoskeletal and a

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.