추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태
buffered aqueous glycerol solution
종 반응성
human
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
기술
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
PGDNECVMELEGLEVVVEARVECEPPPDTQCHVTCQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLYDCSVGHGDCSRCQTAMPQYGCVWC
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... PLXNB1(5364)
일반 설명
Plexin B1 (PLXNB1) gene spanning 21kb with 37 exons is mapped to human chromosome 3p21.31. The encoded protein is predominantly expressed in fetal kidney, digestive system, thyroid, prostate and trachea and is also expressed at lower levels in fetal brain, lung, female reproductive system and liver. PLXNB1 is a member of the plexin family and is characterized with a three IPT (Ig-like, plexins, transcription factors) /TIG domains and one Sema domain.
면역원
plexin B1 recombinant protein epitope signature tag (PrEST)
애플리케이션
Anti-PLXNB1 antibody produced in rabbit has been used in immunohistochemistry.
생화학적/생리학적 작용
Plexin B1 (PLXNB1) interacts with its ligand semaphorin4D (Sema4D) and induces androgen receptor (AR) transcriptional activity by stimulating translocation of AR to the nucleus. It plays a vital role in in signal transduction, intracellular signaling cascade, multicellular organismal development, cell migration, angiogenesis and positive regulation of axonogenesis. Mutation of the gene or elevated expression of the protein is associated with the pathogenesis of prostate cancer. PLXNB1 inhibits the glioma invasiveness and angiogenesis via controlling the Ras homolog gene family, member A (RhoA) /αvβ3/ phosphoinositide-3-kinase/Akt (PI3K/Akt) signaling pathway and serine-arginine protein kinase 1 (SRPK1).Thus, this protein can be considered as a potential therapeutic target for the glioma invasion and angiogenesis.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST79469
물리적 형태
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Oncogene, 35(8), 1066-1072 (2015-05-20)
Semaphorins and their receptors plexins have diverse roles in many cancers affecting tumour growth, metastasis and angiogenesis. Plexin-B1, the receptor for semaphorin4D (Sema4D), has been implicated in prostate cancer where mutation of the gene and overexpression of the protein occur.
Nucleic acids research, 41(Database issue), D920-D924 (2012-11-20)
The Atlas of Genetics and Cytogenetics in Oncology and Haematology (http://AtlasGeneticsOncology.org) is a peer-reviewed internet journal/encyclopaedia/database focused on genes implicated in cancer, cytogenetics and clinical entities in cancer and cancer-prone hereditary diseases. The main goal of the Atlas is to
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 37(8), 11225-11236 (2016-03-06)
Gliomas are one of the most common primary brain tumors in adults. They display aggressive invasiveness, are highly vascular, and have a poor prognosis. Plexin-B1 is involved in numerous cellular processes, especially cellular migration and angiogenesis. However, the role and
Nature neuroscience, 27(8), 1489-1504 (2024-05-28)
Communication between glial cells has a profound impact on the pathophysiology of Alzheimer's disease (AD). We reveal here that reactive astrocytes control cell distancing in peri-plaque glial nets, which restricts microglial access to amyloid deposits. This process is governed by
Nature genetics, 48(5), 556-562 (2016-04-12)
Primary angle closure glaucoma (PACG) is a major cause of blindness worldwide. We conducted a genome-wide association study (GWAS) followed by replication in a combined total of 10,503 PACG cases and 29,567 controls drawn from 24 countries across Asia, Australia
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.