HPA046952

Anti-DDX60 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 60, Anti-FLJ20035
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA046952
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• 면역원 서열: PKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRV
• UniProt 수납 번호: Q8IY21
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... DDX60(55601)

설명

일반 설명

DEXD/H box helicase 60 (DDX60) is an interferon-inducible cytoplasmic helicase. DDX60,also called FLJ20035 is identified as an IFN-inducible gene in human dendritic cells following viral infection. DDX60 is located on human chromosome 4q32.3.

면역원

DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti DDX60 antibodies may be used to detect DDX60 in HepG2-NTCP cells stimulated with IFN-γ using western blotting.

생화학적/생리학적 작용

DEXD/H box helicase 60 (DDX60) helps in RIG-I activation as well as viral RNA degradation. Both mechanisms are necessary for antiviral innate immune responses. DDX60 is used as a novel biomarker for tumorigenesis and diagnosis of oral squamous cell carcinoma (OSCC) specific to subsites such as buccal mucosal, lip and tongue.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST79750

물리적 형태

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable