콘텐츠로 건너뛰기
Merck

SAB1407409

Anti-CD209 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

동의어(들):

CDSIGN, CLEC4L, DC-SIGN, DC-SIGN1, MGC129965

조직 및 계약 가격을 보려면 로그인를 클릭합니다.

크기 선택


제품정보 (DICE 배송 시 비용 별도)

UNSPSC 코드:
12352203
NACRES:
NA.41
기술 서비스
도움이 필요하신가요? 저희 숙련된 과학자 팀이 도와드리겠습니다.
도움 문의
기술 서비스
도움이 필요하신가요? 저희 숙련된 과학자 팀이 도와드리겠습니다.
도움 문의

생물학적 소스

mouse

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

antigen ~45.8 kDa

종 반응성

human

기술

western blot: 1 μg/mL

NCBI 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... CD209(30835)

일반 설명

Cluster of differentiation 209 (CD209), also known as dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin (DC-SIGN), is part of the innate immune system. It is expressed by intestinal dendritic cells and alveolar macrophages. The gene encoding this C-type lectin contains seven exons and is localized on human chromosome 19p13.2.
This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 10332; often referred to as L-SIGN). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.

면역원

CD209 (NP_066978.1, 1 a.a. ~ 404 a.a) full-length human protein.

Sequence
MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA

생화학적/생리학적 작용

Cluster of differentiation 209 (CD209) mediates viral infection and activates immune responses. It activates T-cells and aids in their growth. The protein recognizes various pathogens and triggers immunosuppressive reactions. It is involved in the innate immune system. It recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses that have severe health impacts on humans. CD209/ DC-SIGN mediates the entry of various viruses such as dengue virus, human immunodeficiency virus (HIV), Ebola virus and human cytomegalovirus into the human cells. CD209 acts as an alternative receptor for SARS-CoV-2, a causative agent for the novel coronavirus disease 2019 (COVID-19).

물리적 형태

Solution in phosphate buffered saline, pH 7.4

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Human DC-SIGN binds specific human milk glycans.
Noll AJ, et al.
The Biochemical Journal (2016)
The association between CD209 gene polymorphisms and pulmonary tuberculosis susceptibility: a meta-analysis.
Yi L, et al.
International Journal of Clinical and Experimental Pathology, 8(10), 12437-12437 (2015)
The activation of B cells enhances DC-SIGN expression and promotes susceptibility of B cells to HPAI H5N1 infection.
Na-Ek P, et al.
Biochemical and Biophysical Research Communications, 490(4), 1301-1306 (2017)
Boonrat Tassaneetrithep et al.
The Journal of experimental medicine, 197(7), 823-829 (2003-04-12)
Dengue virus is a single-stranded, enveloped RNA virus that productively infects human dendritic cells (DCs) primarily at the immature stage of their differentiation. We now find that all four serotypes of dengue use DC-SIGN (CD209), a C-type lectin, to infect
Edit I Buzás et al.
Autoimmunity, 39(8), 691-704 (2006-12-21)
The immune system is a complex functional network of diverse cells and soluble molecules orchestrating innate and adaptive immunity. Biological information, to run these intricate interactions, is not only stored in protein sequences but also in the structure of the

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.