SAB1410515

Anti-GCG antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• 동의어(들): GLP1, GLP2, GRPP
• UNSPSC 코드: 12352203
• NACRES: NA.41
• 결합: unconjugated
• application: WB
• 클론: polyclonal
• 종 반응성: human
• citations: 9
• 기술: western blot: 1 μg/mL

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: antigen 20.9 kDa
• 종 반응성: human
• 기술: western blot: 1 μg/mL
• NCBI 수납 번호: NM_002054
• UniProt 수납 번호: P01275
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... GCG(2641)

설명

일반 설명

The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. (provided by RefSeq)

면역원

GCG (NP_002045.1, 1 a.a. ~ 180 a.a) full-length human protein.

Sequence
MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable