콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

SAB2102181

Sigma-Aldrich

Anti-SLC24A6 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-FLJ22233, Anti-NCKX6, Anti-NCLX, Anti-Solute carrier family 24, member 6

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

형태

buffered aqueous solution

분자량

64 kDa

종 반응성

human, rabbit, rat, guinea pig, bovine, mouse, dog, horse

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... SLC24A6(80024)

일반 설명

Solute carrier family 24, member 6 (SLC24A6) or solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 (SLC8B1) gene codes for Na+/Ca2+/Li+ exchanger (NCLX). NCLX belongs to the Na+/Ca2+ exchanger (NCX) family. This protein is expressed at a high level in the brain, skeletal and heart muscle, pancreas β-cells, and lymphocyte B-cells. NCLX contains a small regulatory domain that has a phosphorylation site and lacks Ca2+ binding domains (CBDs).

면역원

Synthetic peptide directed towards the middle region of human SLC24A6

애플리케이션

Anti-SLC24A6 antibody produced in rabbit has been used in western blotting(1:250).

생화학적/생리학적 작용

Solute carrier family 8, member B1 (SLC8B1)/Na+/Ca2+/Li+ exchanger (NCLX) helps in the transportation of the sodium or lithium-ion in exchange for the calcium ion.

서열

Synthetic peptide located within the following region: SIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTE

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Daniel Khananshvili
Molecular aspects of medicine, 34(2-3), 220-235 (2013-03-20)
The SLC8 gene family encoding Na(+)/Ca(2+) exchangers (NCX) belongs to the CaCA (Ca(2+)/Cation Antiporter) superfamily. Three mammalian genes (SLC8A1, SLC8A2, and SLC8A3) and their splice variants are expressed in a tissue-specific manner to mediate Ca(2+)-fluxes across the cell-membrane and thus
Marko Kostic et al.
Seminars in cell & developmental biology, 94, 59-65 (2019-01-19)
Mitochondrial Ca2+ transient is the earliest discovered organellar Ca2+ signaling pathway. It consist of a Ca2+ influx, mediated by mitochondrial Ca2+ uniporter (MCU), and mitochondrial Ca2+ efflux mediated by a Na+/Ca2+ exchanger (NCLX). Mitochondrial Ca2+ signaling machinery plays a fundamental
Vidhya Tangeda et al.
Cell death & disease, 13(3), 241-241 (2022-03-18)
Mitochondria are the major organelles in sensing cellular stress and inducing the response for cell survival. Mitochondrial Lon has been identified as an important stress protein involved in regulating proliferation, metastasis, and apoptosis in cancer cells. However, the mechanism of
Marko Kostic et al.
Cell reports, 25(12), 3465-3475 (2018-12-20)
Calcium is a key regulator of mitochondrial function under both normal and pathological conditions. The mechanisms linking metabolic activity to mitochondrial Ca2+ signaling remain elusive, however. Here, by monitoring mitochondrial Ca2+ transients while manipulating mitochondrial membrane potential (ΔΨm), we found
Thirupura S Shankar et al.
Nature communications, 12(1), 4583-4583 (2021-07-30)
Voltage dependent anion channel 2 (VDAC2) is an outer mitochondrial membrane porin known to play a significant role in apoptosis and calcium signaling. Abnormalities in calcium homeostasis often leads to electrical and contractile dysfunction and can cause dilated cardiomyopathy and

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.