추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
51 kDa
종 반응성
rabbit, human
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SLC2A8(29988)
일반 설명
Solute carrier family 2 member 8 (SLC2A8)/Glucose transporter 8 (GLUT8), a class III sugar transporter, is expressed in the testis and brain. In the brain, GLUT8 is expressed mainly in the cerebral cortex, hippocampus, amygdala, and hypothalamus.
면역원
Synthetic peptide directed towards the middle region of human SLC2A8
생화학적/생리학적 작용
Solute carrier family 2 member 8 (SLC2A8)/glucose transporter 8 (GLUT8) plays a key role in modulating the transport of fructose and the utilization of mammalian fructose. It is a trehalose transporter found in mammals that is necessary for trehalose-induced autophagy. SLC2A8 can also transport intracellular hexose. Hence, it might serve as a multifunctional sugar transporter.
서열
Synthetic peptide located within the following region: VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAW
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Masato Mashima et al.
Neuroscience letters, 636, 90-94 (2016-11-08)
Glucose transporter 8 (GLUT8), a glucose/fructose transporter, has been shown to be expressed in neuronal cells in several brain areas. A recent immunohistochemical study has shown the presence of GLUT8 in the cytoplasm of epithelial cells of the choroid plexus
Allyson L Mayer et al.
Scientific reports, 6, 38586-38586 (2016-12-07)
Trehalose is a disaccharide demonstrated to mitigate disease burden in multiple murine neurodegenerative models. We recently revealed that trehalose rapidly induces hepatic autophagy and abrogates hepatic steatosis by inhibiting hexose transport via the SLC2A family of facilitative transporters. Prior studies
Stefan Schmidt et al.
American journal of physiology. Endocrinology and metabolism, 296(4), E614-E618 (2009-01-30)
GLUT8 is a class III sugar transporter predominantly expressed in testis and brain. In contrast to the class I and class II transporters, hydrophobicity plots predict a short extracellular loop between transmembrane domain (TM)1 and TM2 and a long extracellular
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.