SAB2108215

Anti-SERPINA3 antibody produced in rabbit

affinity isolated antibody

• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 45kDa
• 종 반응성: human, mouse, rat
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunoblotting: suitable
• NCBI 수납 번호: NM_001085
• UniProt 수납 번호: P01011
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SERPINA3(12)

설명

일반 설명

Serpin peptidase inhibitor, clade A member 3 (SERPINA3) is also termed as α1-antichymotrypsin (α1-ACT). It is a 68 kDa serine protease inhibitor, secreted by the liver. It belongs to the serpin superfamily of protease inhibitors. SERPINA3 is located on human chromosome 14q32.1.

면역원

Synthetic peptide directed towards the middle region of human SERPINA3

생화학적/생리학적 작용

Serpin peptidase inhibitor, clade A member 3 (SERPINA3) can block the functions of various serine proteases like chymotrypsin and cathepsin G. It serves as a novel predictor of clinical outcomes and a potential therapeutic target of EC (endometrial carcinoma). SERPINA3 plays a major role in melanoma invasion and migration in extracellular matrix.

서열

Synthetic peptide located within the following region: FRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWRDSL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable