SAB2108901

Anti-PDYN antibody produced in rabbit HRP conjugated

affinity isolated antibody

• 동의어(들): C3orf59
• UNSPSC 코드: 12352203
• NACRES: NA.43

속성

• 생물학적 소스: rabbit
• 결합: peroxidase conjugate
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 27 kDa
• 종 반응성(상동성에 의해 예측): canine, human, horse, goat, sheep, rabbit, bovine, guinea pig, mouse, zebrafish
• 농도: 0.5 mg/mL
• NCBI 수납 번호: NM_024411
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PDYN(5173)

설명

일반 설명

The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

면역원

Synthetic peptide directed towards the middle region of human PDYN

서열

Synthetic peptide located within the following region: SELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGE

물리적 형태

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable