SAB2109074

Anti-ORAI1 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): CRACM1, FLJ14466, ORAT1, TMEM142A
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 33 kDa
• 종 반응성(상동성에 의해 예측): rat, rabbit, yeast, bovine, horse, canine, pig, human
• 농도: 0.5 mg/mL
• 기술: western blot: 1 μg/mL
• NCBI 수납 번호: NM_032790
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ORAI1(57396)

설명

일반 설명

ORAI1 belongs to the Orai family. ORAI1 (CRACM1) is a plasma membrane protein essential for store-operated calcium entry. Defects in ORAI1 are a cause of severe combined immunodeficiency with CRAC channel dysfunction (CRAC-SCID).CRACM1 is a plasma membrane protein essential for store-operated calcium entry (Vig et al., 2006 [PubMed 16645049]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-331 BC075831.1 1-331 332-844 BC013386.1 220-732 845-990 BC075831.1 845-990 991-1490 BG574128.1 52-551 1491-1496 AK027372.1 1235-1240

면역원

Synthetic peptide directed towards the middle region of human ORAI1

서열

Synthetic peptide located within the following region: IGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITP

물리적 형태

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable