SML2836
Lixisenatide
≥95% (HPLC)
동의어(들):
(Des-Pro38)-Exendin-4-(Lys)6 amide, AVE0010, HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2, His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2, ZP10, ZP10A
로그인조직 및 계약 가격 보기
모든 사진(1)
About This Item
실험식(Hill 표기법):
C215H347N61O65S
CAS Number:
Molecular Weight:
4858.49
UNSPSC 코드:
51111800
NACRES:
NA.77
추천 제품
![[Gly14]-Humanin G human ≥95% (HPLC), powder](/deepweb/assets/sigmaaldrich/product/images/189/227/ff2ad0c9-ee19-4c3d-990e-92bd3eb9e672/640/ff2ad0c9-ee19-4c3d-990e-92bd3eb9e672.jpg)
생화학적/생리학적 작용
Lixisenatide (AVE0010, ZP10A) is a C-terminal amidated synthetic glucagon-like peptide-1 receptor (GLP-1R) agonist peptide whose sequence corresponds to Pro38 deleted exendin-4 with a C-terminal extension by six Lys residues. Lixisenatide exhibits 4-times higher human GLP-1R affinity than GLP-1(7-36) amide and dispalys in vivo therapeutic efficacy in murine and rat models of type 2 diabetes, as well as rat models of dox-induced renal fibrosis, global cerebral I/R injury, abdominal aortic aneurysm (AAA) and Aβ25-35 toxicity.
Storage Class Code
11 - Combustible Solids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Preclinical pharmacology of the new GLP-1 receptor agonist AVE0010.
U Werner
Annales d'endocrinologie, 69(2), 164-165 (2008-04-18)
N-F Guo et al.
European review for medical and pharmacological sciences, 23(9), 4017-4026 (2019-05-23)
The aim of this study was to investigate whether Lixisenatide, NF-kB/TNF-α, and TGF-β/Smad pathways exert clear regulatory roles in doxorubicin-induced renal fibrosis in rats, and to explore the possible underlying mechanism. 30 rats were randomly assigned into the sham group
Qini Zhao et al.
Artificial cells, nanomedicine, and biotechnology, 47(1), 2325-2332 (2019-06-09)
Increased free fatty acids (FFA) are one of the risk factors for type 2 diabetes. FFA also contribute to endothelial dysfunction in both the prediabetes and diabetes conditions. Therefore, FFA are an important link between diabetes and endothelial dysfunction. In
Rachael Lennox et al.
Peptides, 61, 38-47 (2014-09-10)
The metabolic benefits of lixisenatide as an anti-diabetic agent are recognized but potential extra-pancreatic effects of this glucagon-like peptide-1 (GLP-1) mimetic in the brain are less well known. This study examines actions within the hippocampus following chronic 40-day peripheral administration
Julie Charpentier et al.
American journal of physiology. Gastrointestinal and liver physiology, 315(5), G671-G684 (2018-08-03)
Endogenous glucagon-like peptide-1 (GLP-1) regulates glucose-induced insulin secretion through both direct β-cell-dependent and indirect gut-brain axis-dependent pathways. However, little is known about the mode of action of the GLP-1 receptor agonist lixisenatide. We studied the effects of lixisenatide (intraperitoneal injection)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.