콘텐츠로 건너뛰기
Merck
모든 사진(3)

주요 문서

WH0004288M1

Sigma-Aldrich

Monoclonal Anti-MKI67 antibody produced in mouse

clone 7B8, purified immunoglobulin, buffered aqueous solution

동의어(들):

Anti-KIA, Anti-Ki67

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

7B8, monoclonal

양식

buffered aqueous solution

종 반응성

human

기술

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

동형

IgG2aκ

GenBank 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... MKI67(4288)

관련 카테고리

일반 설명

Ki-67 (antigen KI-67) has a gene size of 29,545 bp and it consists of 15 exons and 14 introns. It has a minus strand orientation. This gene is located on human chromosome 10q26.2.
This gene encodes a nuclear protein that is associated with and may be necessary for cellular proliferation. Alternatively spliced transcript variants have been described. A related pseudogene exists on chromosome X. (provided by RefSeq)

면역원

MKI67 (NP_002408, 3157 a.a. ~ 3256 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI

애플리케이션

Monoclonal Anti-MKI67 antibody has been used in immunohistochemistry (IHC).

생화학적/생리학적 작용

Ki-67 (antigen KI-67) protein acts as a cellular marker for proliferation. This protein plays a major role in the maintenance and regulation of the cell division cycle. Ki-67, a part of the mitotic chromosome periphery, function as a biological surfactant to maintain individual mitotic chromosomes dispersed in the cytoplasm after nuclear envelope disassembly.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Expression of FOXC2, PinX1, Ki-67 and Cyclin D1 in cutaneous cell carcinoma
Zhao H, et al.
Oncology Letters, 14(1), 635-638 (2017)
Prognostic impact of Ki-67 in patients with gastric cancer-the importance of depth of invasion and histologic differentiation
Ko GH, et al.
Medicine, 96(25) (2017)
Ki-67 acts as a biological surfactant to disperse mitotic chromosomes.
Cuylen S, et al.
Nature, 535(7611), 308-308 (2016)
Haiying Zhao et al.
Oncology letters, 14(1), 635-638 (2017-07-12)
We investigated the expression of FOXC2, PinX1, Ki-67 and Cyclin D1 in cutaneous cell carcinoma. We collected 30 cutaneous squamous cell carcinoma (SCC), 30 cutaneous basal cell carcinoma (BCC) and 30 normal skin tissues. The protein expression and gene expression
C Schlüter et al.
The Journal of cell biology, 123(3), 513-522 (1993-11-01)
The antigen defined by mAb Ki-67 is a human nuclear protein the expression of which is strictly associated with cell proliferation and which is widely used in routine pathology as a "proliferation marker" to measure the growth fraction of cells

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.