추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
2H5, monoclonal
형태
buffered aqueous solution
종 반응성
human
기술
immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... FZD3(7976)
일반 설명
Frizzled class receptor 3 (FZD3) is a receptor with seven-transmembrane domains and it is expressed in human melanocytes. The gene encoding it is localized on human chromosome 8p21.1.
면역원
FZD3 (NP_059108, 55 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV
Sequence
QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV
생화학적/생리학적 작용
Frizzled class receptor 3 (FZD3) modulates the growth of longitudinal axon tracts in the central nervous system. It mediates the dynamics of axon within the enteric, sympathetic and peripheral nervous systems. FZD3 regulates planar cell polarity. Abnormal FZD3 gene methylation causes chromatin structure modifications, associated with congenital hydrocephalus. Mutation in FZD3 gene is associated with Hirschsprung disease, a birth defect lacking the intrinsic ganglion cells of the lower intestine.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Celsr3 and Fzd3 in axon guidance.
The International Journal of Biochemistry & Cell Biology (2015)
Genotype-phenotype association studies of chromosome 8p inverted duplication deletion syndrome.
Fisch GS
Behavior Genetics (2011)
The roles of Frizzled-3 and Wnt3a on melanocyte development: in vitro studies on neural crest cells and melanocyte precursor cell lines.
Chang CH
The Journal of Dermatology (2014)
Impaired methylation modifications of FZD3 alter chromatin accessibility and are involved in congenital hydrocephalus pathogenesis.
Wang L
Brain Research (2014)
Deregulation of the planar cell polarity genes CELSR3 and FZD3 in Hirschsprung disease.
Su L
Experimental and Molecular Pathology, 101(2), 241-248 (2016)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.