WH0200576M1

Monoclonal Anti-PIP5K3 antibody produced in mouse

clone 6C7, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-CFD, Anti-KIAA0981, Anti-MGC40423, Anti-PIKfyve, Anti-PIP5K, Anti-p235, Anti-phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 6C7, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: ELISA: suitable; capture ELISA: suitable; immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: NM_152671
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PIP5K3(200576)

설명

일반 설명

PIP5K3 belongs to a large family of lipid kinases that alter the phosphorylation status of intracellular phosphatidylinositol. Signaling by phosphorylated species of phosphatidylinositol regulates diverse cellular processes, including membrane trafficking and cytoskeletal reorganization (Shisheva et al., 1999 [PubMed 9858586]).[supplied by OMIM

면역원

PIP5K3 (NP_689884, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKGRR

생화학적/생리학적 작용

Phosphatidylinositol-3-phosphate/phosphatidylinositol-5-kinase, type III (PIP5K3) is involved in the synthesis of phosphatidylinositol 3, 5-bisphosphate. It also possesses a protein kinase activity. PIP5K3 regulates specific signaling pathways as well as membrane trafficking. Mutations in the gene encoding it are associated with fleck corneal dystrophy.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)