AV32383

Anti-SIX6 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-Sine oculis homeobox homolog 6 (Drosophila)
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 28 kDa
• species reactivity: guinea pig, bovine, mouse, human, dog, rat, sheep, horse, rabbit
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_031400
• UniProt accession no.: O95475
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... SIX6(4990)

Description

General description

SIX6 is a homeobox protein and may regulate eye development. Studies have linked homozygous truncations in SIX6 to complex microphthalmia in humans.
Rabbit Anti-SIX6 antibody recognizes chicken, bovine, canine, zebrafish, human, mouse, rat, and pig SIX6.

Immunogen

Synthetic peptide directed towards the N terminal region of human SIX6

Application

Rabbit Anti-SIX6 antibody can be used for western blot (0.5μg/ml) and IHC (4-8μg/ml) applications.

Biochem/physiol Actions

SIX6 is a member of SIX family. It is the homologue of the chick Six6(Optx2) gene. SIX6 is closely related to SIX3 and is expressed in the developing and adult human retina.

Sequence

Synthetic peptide located within the following region: PAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQAL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable