AV38089

Anti-E2F3 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-E2F transcription factor 3
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 49 kDa
• species reactivity: mouse, human, dog, guinea pig, rat, horse, bovine
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_001940
• UniProt accession no.: Q68DT0
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... E2F3(1871)

Description

General description

E2F transcription factors are key regulators of cell growth, differentiation and cell death. E2F transcription factor 3 (E2F3) can be induced by DNA damage through transcriptional and posttranslational mechanisms wherein it functions as a master regulator of DNA damage response. E2F3, a transcriptional effector that commits cells to enter and progress through S phase, is uniquely amplified in specific human tumours, such as prostate cancer, where its expression is inversely correlated with the survival of patients.

Specificity

Anti-E2F3 polyclonal antibody reacts with canine, human, mouse, rat, and bovine E2F transcription factor 3 proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human E2F3

Application

Anti-E2F3 polyclonal antibody is used to tag E2F transcription factor 3 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of E2F transcription factor 3 in the regulation of cell growth, differentiation and cell death and as an oncogene.

Biochem/physiol Actions

E2F3 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. E2F3 binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner.

Sequence

Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 2
• flash_point_f: Not applicable
• flash_point_c: Not applicable