MSST0048
SILu™Lite SOST, Sclerostin human
recombinant, expressed in HEK 293 cells, MS Protein Standard
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
Recommended Products
biological source
human
Quality Level
recombinant
expressed in HEK 293 cells
tag
8-His tagged
assay
≥98% (SDS-PAGE)
form
lyophilized powder
technique(s)
mass spectrometry (MS): suitable
suitability
suitable for mass spectrometry (internal calibrator)
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... SOST(50964)
General description
SILu™Lite SOST is a recombinant human protein expressed in human 293 cells. It consists of 201 amino acids (including a N-terminal polyhistidine and tag), with a calculated molecular mass of 22.8 kDa. SILu™Lite SOST is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Biochem/physiol Actions
Sclerostin is a secreted Wnt signaling antagonist produced almost exclusively by osteocytes. It can selectively inhibit Wnt/ β-catenin, suppressing the activity of osteoblasts as well as the viability of osteoblasts and osteocytes. Lower sclerostin levels are associated with lower bone mineral content and bone. It was demonstrated that greater total limb bone mineral content was significantly associated with greater circulating levels of sclerostin. In addition, circulating sclerostin is a biomarker of osteoporosis severity in long-term, chronic paraplegia. Serum sclerostin was associated significantly, independently, and positively with bone mineral density of both cortical and cancellous bone. Sclerostin is considered to be one of the factors associated with chronic kidney disease-mineral and bone disorder in hemodialysis patients.
Sequence
HHHHHHHHGGQQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.
Legal Information
SILu is a trademark of Sigma-Aldrich Co. LLC
Storage Class
11 - Combustible Solids
wgk_germany
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service