SAB1402733

Monoclonal Anti-COL9A3 antibody produced in mouse

clone 2B5, ascites fluid

• Synonym(s): DJ885L7.4.1, EDM3, FLJ90759, IDD, MED
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 2B5, monoclonal
• mol wt: antigen ~32.6 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1:500-1:1000
• isotype: IgMκ
• NCBI accession no.: NM_001853
• UniProt accession no.: Q14050
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... COL9A3(1299)

Description

General description

This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. Mutations in this gene are associated with multiple epiphyseal dysplasia. (provided by RefSeq)

Immunogen

COL9A3 (NP_001844, 280 a.a. ~ 338 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GDLGRPGPKGTPGVAGPSGEPGMPGKDGQNGVPGLDGQKGEAGRNGAPGEKGPNGLPGL

Physical form

Clear solution

Safety Information

• Storage Class: 11 - Combustible Solids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable