SAB1402828

Monoclonal Anti-KCNA1, (C-terminal) antibody produced in mouse

clone 2D8, purified immunoglobulin, buffered aqueous solution

• Synonym(s): AEMK, EA1, HBK1, HUK1, KV1.1, MBK1, MGC126782, MGC138385, MK1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2D8, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~35.57 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_000217
• UniProt accession no.: Q09470
• shipped in: dry ice
• Storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... KCNA1(3736)

Description

General description

This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK). (provided by RefSeq)

Immunogen

KCNA1 (NP_000208.1, 410 a.a. ~ 495 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NFNYFYHRETEGEEQAQLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTDV

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable