SAB1403423

Monoclonal Anti-SCGB3A1 antibody produced in mouse

clone 3G5, purified immunoglobulin, buffered aqueous solution

• Synonym(s): HIN-1, HIN1, LU105, MGC87867, PnSP-2, UGRP2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3G5, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.55 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable
• isotype: IgG2aκ
• NCBI accession no.: BC029176
• UniProt accession no.: Q96QR1
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SCGB3A1(92304)

Description

General description

Secretoglobin family 3A member 1 (SCGB3A1) is a member of secretoglobin gene super family, which contains small secretory proteins. SCGB3A1 is expressed mainly in the epithelial organs, such as the lungs, breast glands, trachea, prostate and salivary glands. SCGB3A1 gene is located on human chromosome 5q35.3.

Immunogen

SCGB3A1 (AAH29176, 1 a.a. ~ 104 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG

Biochem/physiol Actions

Secretoglobin family 3A member 1 (SCGB3A1) plays an important role in cell growth, migration and invasion as a potent inhibitor and these activities are mediated through protein kinase B (PKB/AKT) signal pathway. Aberrant mutations of SCGB3A1 may be used as a prognostic marker for breast cancer and other human malignancies. SCGB3A1 is used as an epigenetic marker for therapy selection in glioblastoma multiforme (GBM). SCGB3A1 plays an important role in inflammation.

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable