SAB1404590

Monoclonal Anti-LIPF, (C-terminal) antibody produced in mouse

clone 3B3, purified immunoglobulin, buffered aqueous solution

• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3B3, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.11 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• NCBI accession no.: NM_004190
• UniProt accession no.: P07098
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... LIPF(8513)

Description

General description

This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism. (provided by RefSeq)

Immunogen

LIPF (NP_004181, 299 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable