SAB1407175

Anti-ERC1 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Synonym(s): Cast2, ELKS, KIAA1081, MGC12974, RAB6IP2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: antigen ~10 kDa
• species reactivity: human
• technique(s): western blot: 1 μg/mL
• NCBI accession no.: XM_936908.1
• UniProt accession no.: Q8IUD2
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ERC1(23085)

Description

General description

The protein encoded by this gene is a member of a family of RIM-binding proteins. RIMs are active zone proteins that regulate neurotransmitter release. This gene has been found fused to the receptor-type tyrosine kinase gene RET by gene rearrangement due to the translocation t(10;12)(q11;p13). Multiple transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

ERC1 (AAH05065.1, 1 a.a. ~ 91 a.a) full-length human protein.

Sequence
MPKQVVWHGHWPAALSKQVAQIPPTWTFSSGAAPATLSHWVCDSPLHLSILHHFPSRKTDGRKPSVTLLLRRSISGTDIICLVSVNSKESS

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable