MilliporeSigma
All Photos(1)

Documents

WH0000975M1

Sigma-Aldrich

Monoclonal Anti-CD81 antibody produced in mouse

clone 2B7, purified immunoglobulin, buffered aqueous solution

Sign Into View Organizational & Contract Pricing

Synonym(s):
Anti-CD81 antigen (target of antiproliferative antibody 1), Anti-S5.7, Anti-TAPA1, Anti-TSPAN28
MDL number:
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2B7, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CD81(975)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
SAB4700936WH0000926M7SAB4700734
antibody form

purified immunoglobulin

antibody form

-

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

biological source

mouse

biological source

mouse

biological source

mouse

biological source

mouse

conjugate

unconjugated

conjugate

-

conjugate

unconjugated

conjugate

unconjugated

species reactivity

human

species reactivity

rabbit, cat, human

species reactivity

human

species reactivity

rat

Gene Information

human ... CD81(975)

Gene Information

human ... CD81(975)

Gene Information

human ... CD8B(926)

Gene Information

rat ... Cd8a(24930)

Still not finding the right product?  

Give our Product Selector Tool a try.

General description

Cluster of differentiation 81(CD81), also known as target of antiproliferative antibody 1 (TAPA-1), is encoded by the gene mapped to human chromosome 11p15.5. The encoded protein belongs to the tetraspanin family and is mainly expressed on the oocyte surface. CD81 is characterized with a five large helical segments.
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. (provided by RefSeq)

Immunogen

CD81 (AAH02978, 25 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFY

Biochem/physiol Actions

Cluster of differentiation 81 (CD81) has a role in membrane organization, cell-cell interactions, cellular fusion and protein trafficking. It is also implicated in receptor clustering and signaling. CD81 acts as a putative receptor for hepatitis C virus (HCV) and facilitates the HCV glycoprotein-dependent viral cell entry. Elevated expression of the gene has been observed in various types of cancers.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

CD81 Is Required for Hepatitis C Virus Glycoprotein-Mediated Viral Infection
Zhang J
Journal of Virology, 78, 1448-1455 (2004)
A role for CD81 and hepatitis C virus in hepatoma mobility.
Brimacombe CL
Viruses, 6, 1454-1472 (2014)
CD81 as a tumor target.
Vences-Catalan F
Biochemical Society Transactions, 45, 531-535 (2017)
Oligomerization of the Tetraspanin CD81 via the Flexibility of Its ?-Loop.
Schmidt TH
Biophysical Journal, 110, 2463-2474 (2016)
CD81 (TAPA-1): A MOLECULE INVOLVED IN SIGNAL TRANSDUCTION AND CELL ADHESION IN THE IMMUNE SYSTEM
Levy S
Annual Review of Immunology, 16, 89-109 (1998)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service