Skip to Content
MilliporeSigma
All Photos(4)

Key Documents

WH0002940M1

Sigma-Aldrich

Monoclonal Anti-GSTA3 antibody produced in mouse

clone 1F11, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-GSTA33, Anti-GTA3, Anti-MGC22232, Anti-glutathione S-transferase A3

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1F11, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GSTA3(2940)

General description

Glutathione S-transferase alpha 3 (GSTA3) has two isoforms, that is cytosolic and membrane-bound, which are encoded by two distinct supergene families. These enzymes are involved in cellular defence against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyses the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined. (provided by RefSeq)GSTA3 is a adipocyte differentiation-associated protein. It is expressed in steroidogenic tissues. The protein belongs to the family of detoxifying and cytoprotective enzymes.

Immunogen

GSTA3 (AAH20619, 1 a.a. ~ 222 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF

Biochem/physiol Actions

Glutathione S-transferase alpha 3 (GSTA3) is involved in the metabolism of electrophilic xenobiotic and endobiotic toxic compounds. It may be used as a target for prescribing medication in steroid hormone-dependent diseases. This protein is related to diseases associated with oxidation-regulating proteins. It is used as a therapeutic target for renal interstitial fibrosis (RIF).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Glutathione S-transferase polymorphisms: cancer incidence and therapy
McIlwain CC, et al.
Oncogene, 25(11), 1639-1639 (2006)
Expression of the murine glutathione S-transferase ?(GSTA3) subunit is markedly induced during adipocyte differentiation: activation of the GSTA3 gene promoter by the pro-adipogenic eicosanoid 15-deoxy-?12, 14-prostaglandin J 2
Jowsey IR, et al.
Biochemical and Biophysical Research Communications, 312(4), 1226-1235 (2003)
GSTA3 attenuates renal interstitial fibrosis by inhibiting TGF-beta-induced tubular epithelial-mesenchymal transition and fibronectin expression
Xiao Y, et al.
PLoS ONE, 11(9), e0160855-e0160855 (2016)
Isomerization of ?5-androstene-3, 17-dione into ?4-androstene-3, 17-dione catalyzed by human glutathione transferase A3-3: a computational study identifies a dual role for glutathione
Dourado DF, et al.
The Journal of Physical Chemistry A, 118(31), 5790-5800 (2014)
Françoise Raffalli-Mathieu et al.
The Biochemical journal, 414(1), 103-109 (2008-04-23)
hGSTA3-3 (human Alpha-class glutathione transferase 3-3) efficiently catalyses steroid Delta(5)-Delta(4) double-bond isomerization in vitro, using glutathione as a cofactor. This chemical transformation is an obligatory reaction in the biosynthesis of steroid hormones and follows the oxidation of 3beta-hydroxysteroids catalysed by

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service