AV32439

Anti-OTX2 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-Orthodenticle homeobox 2
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 32 kDa
• 종 반응성: human, bovine, dog, guinea pig, horse, rabbit, sheep, mouse, rat
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_068374
• UniProt 수납 번호: P32243-2
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... OTX2(5015)

설명

일반 설명

OTX2 is a homeodomain transcription factor that regulates organ development. Studies in mice have shown that Otx2 is involved in determining the fate of retinal photoreceptor cells. This transcription factor has also been implicated in pineal gland development.
Rabbit Anti-OTX2 antibody recognizes canine, chicken, human, mouse, rat, rabbit, zebrafish, and bovine OTX2.

면역원

Synthetic peptide directed towards the N terminal region of human OTX2

애플리케이션

Rabbit Anti-OTX2 antibody can be used for western blot applications at a concentration of 1.0-10.0μg/ml. It can also be used for IHC applications at 4-8μg/ml.

생화학적/생리학적 작용

Homeobox protein OTX2 is a member of the bicoid sub-family of homeodomain-containing transcription factors. This protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper forebrain development. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants may exist, but their full length sequences have not been determined. This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper forebrain development. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants may exist, but their full length sequences have not been determined.

서열

Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable