콘텐츠로 건너뛰기
Merck
모든 사진(3)

Key Documents

AV35459

Sigma-Aldrich

Anti-KCNQ2 antibody produced in rabbit

IgG fraction of antiserum

동의어(들):

Anti-Potassium voltage-gated channel, KQT-like subfamily, member 2

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

형태

buffered aqueous solution

분자량

43 kDa

종 반응성

human, horse, dog, mouse, bovine, guinea pig, rat

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... KCNQ2(3785)

관련 카테고리

일반 설명

Potassium voltage-gated channel subfamily Q member 2 (KCNQ2) gene, which codes for voltage-gated potassium channel subunits, is mostly expressed in the brain. KCNQ2 is made up of heteromultimeric channels with six transmembrane domains (S1–S6) in each subunit. It belongs to the voltage-gated potassium channels (KCNQ) gene subfamily. KCNQ2 gene is located on human chromosome 20q13.33.

면역원

Synthetic peptide directed towards the middle region of human KCNQ2

생화학적/생리학적 작용

Potassium voltage-gated channel subfamily Q member 2 (KCNQ2) plays a vital role in neurodevelopment. Mutations in the KCNQ2 gene are associated with benign familial neonatal infantile seizures (BFNIS), benign familial neonatal convulsions (BFNC), benign familial infantile seizures (BFIS), and neonatal onset epileptic encephalopathy (EE).

서열

Synthetic peptide located within the following region: GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Franchette T Pascual et al.
Epilepsy & behavior case reports, 1, 35-38 (2013-01-01)
Benign familial neonatal seizures (BFNS) is an autosomal dominant disorder associated with heterozygous mutations of either the KCNQ2 or KCNQ3 gene. Most cases have mutations of the KCNQ2 gene. A handful of cases with KCNQ2 and CHRNA4 deletions have been
Nina Dirkx et al.
Frontiers in physiology, 11, 570588-570588 (2020-11-17)
Kv7.2 subunits encoded by the KCNQ2 gene constitute a critical molecular component of the M-current, a subthreshold voltage-gated potassium current controlling neuronal excitability by dampening repetitive action potential firing. Pathogenic loss-of-function variants in KCNQ2 have been linked to epilepsy since
Inn-Chi Lee et al.
Molecular genetics & genomic medicine, 7(7), e00816-e00816 (2019-06-15)
Epilepsy caused by a KCNQ2 gene mutation usually manifests as neonatal seizures during the first week of life. The genotypes and phenotypes of KCNQ2 mutations are noteworthy. The KCNQ2 sequencings done were selected from 131 nonconsanguineous pediatric epileptic patients (age

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.