AV39466

Anti-NR2F2 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-Nuclear receptor subfamily 2, group F, member 2
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 46 kDa
• 종 반응성: dog, rabbit, human, guinea pig, sheep, horse, rat, mouse, bovine
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_066285
• UniProt 수납 번호: P24468
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... NR2F2(7026)

설명

일반 설명

COUP transcription factor 2/nuclear receptor subfamily 2, group F, member 2 (COUP-TFII, NR2F2) is a nuclear receptor that regulates amygdale patterning via expression of neurophilin.COUP-TFII is a component of the glucagon-like peptide 1 (GLP-1) signaling cascade that stimulates neonatal β-cell number. COUP-TFII is required for GLP-1 activation of the β-catenin-dependent pathway.

특이성

Anti-NR2F2 (AB1) polyclonal antibody reacts with chicken, bovine, pig, zebrafish, human, mouse, rat, and canine COUP transcription factor 2 proteins.

면역원

Synthetic peptide directed towards the C terminal region of human NR2F2

애플리케이션

Anti-NR2F2 (AB1) polyclonal antibody is used to tag COUP transcription factor 2/nuclear receptor subfamily 2, group F, member 2 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of COUP transcription factor 2 in cell signaling pathways such as the glucagon-like peptide 1 (GLP-1) signaling cascade.

생화학적/생리학적 작용

NR2F2, an orphan member of the nuclear hormone receptor superfamily, acts as a transcriptional repressor by antagonizing the functions of other nuclear hormone receptors and by actively silencing transcription. However, in certain contexts, NR2F2 stimulates transcription directly. NR2F2, MyoD and p300 interact in a competitive manner, and that increasing amounts of NR2F2 have the ability to reduce the interaction between myoD and p300 invitro. NR2F2 post-transcriptionally regulates myoD activity/function, and that crosstalk between orphan nuclear receptors and the myogenic bHLH proteins has functional consequences for differentiation.

서열

Synthetic peptide located within the following region: EYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable