AV41490
Anti-Fibronectin Antibody
rabbit polyclonal
동의어(들):
Fn1 Antibody, Fn1 Antibody - Anti-FN1 antibody produced in rabbit, Anti-CIG, Anti-DKFZp686F10164, Anti-DKFZp686H0342, Anti-DKFZp686I1370, Anti-DKFZp686O13149, Anti-FINC, Anti-FN, Anti-Fibronectin 1
로그인조직 및 계약 가격 보기
모든 사진(2)
About This Item
UNSPSC 코드:
12352203
NACRES:
NA.41
추천 제품
제품명
Anti-FN1 antibody produced in rabbit, affinity isolated antibody
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
76 kDa
종 반응성
bovine, dog, sheep, pig, human
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... FN1(2335)
관련 카테고리
일반 설명
Fibronectins are a class of immunochemically related glycoproteins present in basement membranes, collective tissues and blood wherein they mediate adhesion between matrix components and cells. Plasma fibronectin (CLG) mediates the attachment of monocytes (fibroblasts, macrophages) to various cell matrices and materials such as gelatin.
특이성
Anti-FN1 polyclonal antibody reacts with human, canine, rabbit, bovine, rat, and mouse plasma fibronectin (CIG).
면역원
Synthetic peptide directed towards the C terminal region of human FN1
애플리케이션
Anti-FN1 polyclonal antibody is used to tag plasma fibronectin (CIG) for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of fibronectin (CIG) in the adherence of monocytes to cell matricies and solid surfaces coated with materials such as gelatin.
생화학적/생리학적 작용
FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis.
서열
Synthetic peptide located within the following region: NCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
이미 열람한 고객
Donor-But Not Recipient-Derived Cells Produce Collagen-1 in Chronically Rejected Cardiac Allografts.
Saidou Balam et al.
Frontiers in immunology, 12, 816509-816509 (2022-02-08)
Fibrosis is a prominent feature of chronic allograft rejection, caused by an excessive production of matrix proteins, including collagen-1. Several cell types produce collagen-1, including mesenchymal fibroblasts and cells of hematopoietic origin. Here, we sought to determine whether tissue-resident donor-derived
Simone Buchtler et al.
Journal of the American Society of Nephrology : JASN, 29(7), 1859-1873 (2018-05-20)
Background Interstitial fibrosis is associated with chronic renal failure. In addition to fibroblasts, bone marrow-derived cells and tubular epithelial cells have the capacity to produce collagen. However, the amount of collagen produced by each of these cell types and the
Guiqin Song et al.
Oncotarget, 8(11), 17771-17784 (2017-02-02)
Esophageal cancer is a highly aggressive malignancy with very poor overall prognosis. Given the strong clinical relevance of SATB1 in esophagus cancer and other cancers suggested by previous studies, the exact function of SATB1 in esophagus cancer development is still
Saidou Balam et al.
Journal of immunology (Baltimore, Md. : 1950), 202(12), 3514-3523 (2019-05-10)
Chronic rejection is a major problem in transplantation medicine, largely resistant to therapy, and poorly understood. We have shown previously that basophil-derived IL-4 contributes to fibrosis and vasculopathy in a model of heart transplantation with depletion of CD4+ T cells.
Xianghui Chen et al.
Kidney international, 95(4), 880-895 (2019-02-23)
Ectopic fat deposition (EFD) in the kidney has been shown to play a causal role in diabetic nephropathy; however, the mechanism underlying EFD remains elusive. By transcriptome analysis, we found decreased expression levels of disulfide-bond A oxidoreductase-like protein (DsbA-L) in
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.