콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV46276

Sigma-Aldrich

Anti-ASF1B antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-ASF1 anti-silencing function 1 homolog B (S. cerevisiae), Anti-CIA-II, Anti-FLJ10604

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

22 kDa

종 반응성

rat, guinea pig, mouse, human, bovine, dog

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... ASF1B(55723)

면역원

Synthetic peptide directed towards the middle region of human ASF1B

애플리케이션

Anti-ASF1B antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/ml.

생화학적/생리학적 작용

ASF1B [anti-silencing function 1 homolog B (S. cerevisiae)] gene encodes for a protein that belongs to H3/H4 family of histone chaperone proteins and facilitates the histone deposition as well as histone exchange and removal during nucleosome assembly and disassembly. ASF1B interacts with HCF-1 and regulates the progression of cellular DNA replication forks through chromatin reorganization. It also stimulates the viral DNA replication by combining Asf1b to DNA replication components. Additionally, depletion of both the histone chaperones ASF1a and ASF1b in human cells induces hallmark of alternative lengthening of telomeres (ALT) in primary as well as cancer cells.

서열

Synthetic peptide located within the following region: YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Angélique Galvani et al.
Molecular and cellular biology, 28(11), 3672-3685 (2008-04-02)
Histone chaperones have been implicated in nucleosome assembly and disassembly as well as histone modification. ASF1 is a highly conserved histone H3/H4 chaperone that synergizes in vitro with two other histone chaperones, chromatin assembly factor 1 (CAF-1) and histone repression
Roderick J O'Sullivan et al.
Nature structural & molecular biology, 21(2), 167-174 (2014-01-15)
The mechanism of activation of the alternative lengthening of telomeres (ALT) pathway of mammalian chromosome-end maintenance has been unclear. We have now discovered that co-depletion of the histone chaperones ASF1a and ASF1b in human cells induced all hallmarks of ALT
Hua Peng et al.
Proceedings of the National Academy of Sciences of the United States of America, 107(6), 2461-2466 (2010-02-06)
The cellular transcriptional coactivator HCF-1 interacts with numerous transcription factors as well as other coactivators and is a component of multiple chromatin modulation complexes. The protein is essential for the expression of the immediate early genes of both herpes simplex

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.