콘텐츠로 건너뛰기
Merck
모든 사진(6)

주요 문서

HPA010593

Sigma-Aldrich

Anti-FOLH1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-Glutamate carboxypeptidase 2 antibody produced in rabbit, Anti-Glutamate carboxypeptidase II antibody produced in rabbit, Anti-Membrane glutamate carboxypeptidase antibody produced in rabbit, Anti-N-acetylated-α-linked acidic dipeptidase I antibody produced in rabbit, Anti-NAALADase I antibody produced in rabbit, Anti-Pteroylpoly-γ-glutamate carboxypeptidase antibody produced in rabbit, Anti-mGCP antibody produced in rabbit

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

기술

immunohistochemistry: 1:200- 1:500

면역원 서열

ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNF

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... FOLH1(2346)

일반 설명

FOLH1 (folate hydrolase 1) is a type II membrane protein, which is composed of a cytosolic domain, a transmembrane region, and an exoplasmic region. This protein exhibits both constitutive and induced internalization. It is an exopeptidase, which is Zn-dependent and is localized on the brush-border of the intestine.

면역원

Glutamate carboxypeptidase 2 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-FOLH1 antibody produced in rabbit has been used for FACS (flourescence activated cell sorting)-based epitope mapping. Anti-FOLH1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

FOLH1 (folate hydrolase 1) is also known as prostate-specific membrane antigen (PSMA) and is over and strongly expressed in prostate cancer cells, including metastatic cells. This protein functions both as an N-acetylated a-linked acidic dipeptidase (NAALADase) and folate hydrolase (FOLH). In small intestine, it is responsible for the absorption of dietary polyglutamylated folates (folyl-n-γ-l-glutamic acid), which are the provitamin form of folic acid. Variants in this gene are linked with folate nutritional status and disease susceptibility, and its interaction with dietary natural vitamin C might be linked with the susceptibility to adenomatous polyp.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST71680

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Jeong-Hwa Choi et al.
Asian Pacific journal of cancer prevention : APJCP, 16(10), 4383-4386 (2015-06-02)
The C1561T variant of the glutamate carboxypeptidase II (GCPII) gene is critical for natural methylfolylpolyglutamte (methylfolate) absorption, and has been associated with perturbations in folate metabolism and disease susceptibility. However, little is known on C1561T-GCPII as a risk factor for
Tiancheng Liu et al.
International journal of oncology, 44(3), 918-922 (2014-01-16)
Developing simple and effective approaches to detect tumor markers will be critical for early diagnosis or prognostic evaluation of prostate cancer treatment. Prostate‑specific membrane antigen (PSMA) has been validated as an important tumor marker for prostate cancer progression including angiogenesis
Michal Navrátil et al.
The FEBS journal, 281(14), 3228-3242 (2014-05-28)
In addition to its well-characterized role in the central nervous system, human glutamate carboxypeptidase II (GCPII; Uniprot ID Q04609) acts as a folate hydrolase in the small intestine, participating in the absorption of dietary polyglutamylated folates (folyl-n-γ-l-glutamic acid), which are
Elton P Hudson et al.
Scientific reports, 2, 706-706 (2012-10-11)
As antibody-based diagnosis and therapy grow at an increased pace, there is a need for methods which rapidly and accurately determine antibody-antigen interactions. Here, we report a method for the multiplex determination of antibody epitopes using bacterial cell-surface display. A
Martin K Bakht et al.
Endocrine-related cancer, 26(2), 131-146 (2018-11-08)
Prostate-specific membrane antigen (PSMA) is overexpressed in most prostate adenocarcinoma (AdPC) cells and acts as a target for molecular imaging. However, some case reports indicate that PSMA-targeted imaging could be ineffectual for delineation of neuroendocrine (NE) prostate cancer (NEPC) lesions

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.