추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태
buffered aqueous glycerol solution
종 반응성
human
향상된 검증
recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
기술
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... EMP2(2013)
일반 설명
EMP2 (epithelial membrane protein 2) belongs to the family of four-transmembrane domains proteins called growth arrest-specific gene 3 (GAS-3)/peripheral myelin protein 22 (PMP22). It is a transmembrane protein, which spans the membrane four times. It is predominantly expressed in secretory endometrium, alveolar epithelium in lungs, and in eye in the retinal pigmented epithelium. This protein has three predicted N-linked glycosylation sites, two exoplasmic domains, and a short cytolsolic tail. It is a tumor suppressor gene for certain cancers such as, B-cell lymphoma.
면역원
Epithelial membrane protein 2 recombinant protein epitope signature tag (PrEST)
Sequence
DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST
Sequence
DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST
애플리케이션
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
생화학적/생리학적 작용
EMP2 (epithelial membrane protein 2) is involved in blastocyst implantation, where it controls the surface expression and localization of integrin αvβ3. It is up-regulated in endometrioid ovarian tumors, which is associated with poor prognosis and survival. It is involved in controlling the correct trafficking of glycolipids and multiple proteins from post-Golgi endosomes to plasma membrane. It also regulates the proper trafficking of specific molecules to glycolipids-enriched lipid raft microdomains (GEMs). It interacts with and activates focal adhesion kinase (FAK) and the FAK/Src complex, which in turn facilitates collagen gel contraction. This gene is also down-regulated in nasopharyngeal carcinoma (NPC), especially in high grade cases. In NPC, it might be involved in increases tumor aggressiveness, and poor prognosis. It is highly up-regulated in triple negative breast cancer and invasive breast cancer. It might have potential as a therapeutic target for the same.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST73193
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Maoyong Fu et al.
Molecular cancer therapeutics, 13(4), 902-915 (2014-01-23)
Despite significant advances in biology and medicine, the incidence and mortality due to breast cancer worldwide is still unacceptably high. Thus, there is an urgent need to discover new molecular targets. In this article, we show evidence for a novel
Shawn A Morales et al.
Investigative ophthalmology & visual science, 50(1), 462-469 (2008-05-13)
Proliferative vitreoretinopathy (PVR) occurs in approximately 10% of patients after retinal detachment. PVR results from a multiphase process that leads to an aberrant wound-healing strategy with contractile cellular forces and tractional retinal detachment (TRD). Epithelial membrane protein (EMP) 2 controls
Yi-Wen Wang et al.
The American journal of pathology, 183(3), 709-719 (2013-07-11)
Upper urinary tract urothelial carcinoma is a relatively uncommon disease and is diagnosed more frequently at advanced stages. The prognosis of these patients mainly has been related to tumor stage and grade. As a result, the definition of prognostic indicators
Hussain Gadelkarim Ahmed et al.
Asian Pacific journal of cancer prevention : APJCP, 16(2), 653-656 (2015-02-17)
Nasopharyngeal carcinoma (NPC) is an aggressive disease and tends to involve surrounding tissues, and biomarkers for better management are yet to be identified. One hundred and fifty tissue samples with NPC diagnosis were were investigated using pan cytokeratin (CK) and
Viola K Weinheimer et al.
The Journal of infectious diseases, 206(11), 1685-1694 (2012-07-26)
Highly pathogenic avian H5N1 influenza viruses preferentially infect alveolar type II pneumocytes in human lung. However, it is unknown whether this cellular tropism contributes to high viral virulence because the primary target cells of other influenza viruses have not been
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.