추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
기술
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
FDDGDYFPVWGTCLGFEELSLLISGECLLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKLKK
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... GGH(8836)
일반 설명
The gene GGH (γ-glutamyl hydrolase) is mapped to human chromosome 8q12.1. The protein is mainly present in the lysosomes.
면역원
Gamma-glutamyl hydrolase Precursor recombinant protein epitope signature tag (PrEST)
애플리케이션
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-GGH antibody produced in rabbit has been used for immunohistochemistry and western blotting.
Anti-GGH antibody produced in rabbit has been used for immunohistochemistry and western blotting.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)
Immunohistochemistry (1 paper)
Western Blotting (1 paper)
생화학적/생리학적 작용
GGH (γ-glutamyl hydrolase) is involved in the removal of γ-linked polyglutamates, thereby hydrolysing (anti)folylpoly-γ-glutamates. The enzyme controls the intracellular folate pools and folate metabolism. During the treatment of acute lymphoblastic leukemia (ALL), mutation in the GGH gene is linked with efficacy and side effects of methotrexate (MTX). It is responsible for changing a long-chain methotrexate polyglutamates (MTX-PGs) into a short-chain MTX-PGs and finally to MTX. Mutation in this gene at -401C>T enhances the response of cisplatin-based chemoradiotherapy in cervical carcinoma. The levels of GGH are higher in invasive breast cancer tumors and are associated with the development and progression of the cancer.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST74642
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Nathaniel Melling et al.
International journal of molecular sciences, 18(2) (2017-02-02)
γ-glutamyl-hydrolase (GGH) is a ubiquitously-expressed enzyme that regulates intracellular folate metabolism for cell proliferation, DNA synthesis, and repair. Employing GGH immunohistochemistry on a tissue microarray with 12,427 prostate cancers, we found that GGH expression was negative to low in normal
Proteomic analysis of human substantia nigra identifies novel candidates involved in Parkinson's disease pathogenesis.
Licker V, et al.
Proteomics, 14, 784-794 (2014)
Virginie Licker et al.
Proteomics, 14(6), 784-794 (2014-01-23)
Parkinson's disease (PD) pathology spreads throughout the brain following a region-specific process predominantly affecting the substantia nigra (SN) pars compacta. SN exhibits a progressive loss of dopaminergic neurons responsible for the major cardinal motor symptoms, along with the occurrence of
Identification of carboxypeptidase E and gamma-glutamyl hydrolase as biomarkers for pulmonary neuroendocrine tumors by cDNA microarray.
He P, et al.
Human Pathology, 35, 1196-1209 (2004)
The impact of GGH -401C>T polymorphism on cisplatin-based chemoradiotherapy response and survival in cervical cancer.
Silva IH, et al.
Gene, 512, 247-250 (2013)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.