SAB2100693

Anti-EPOR antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-Erythropoietin receptor, Anti-MGC138358
• MDL number: MFCD01092334
• UNSPSC 코드: 12352203
• PubChem Substance ID: 329824639
• NACRES: NA.41
• 결합: unconjugated
• application: WB
• 클론: polyclonal
• 종 반응성: human, mouse, dog, rat
• citations: 1
• 기술: western blot: suitable

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 53 kDa
• 종 반응성: human, mouse, dog, rat
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• UniProt 수납 번호: P19235
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• SMILES string: O(C(=O)CCCCCCCCC\C=C/CCCCCCCC)C(=O)CCCCCCCCC\C=C/CCCCCCCC
• InChI: 1S/C40H74O3/c1-3-5-7-9-11-13-15-17-19-21-23-25-27-29-31-33-35-37-39(41)43-40(42)38-36-34-32-30-28-26-24-22-20-18-16-14-12-10-8-6-4-2/h17-20H,3-16,21-38H2,1-2H3/b19-17-,20-18-
• InChI key: QLXNJYBNAORLFC-CLFAGFIQSA-N
• 유전자 정보: human ... EPOR(2057)

설명

면역원

Synthetic peptide directed towards the N terminal region of human EPOR

애플리케이션

Anti-EPOR antibody produced in rabbit has been used in immunoblot analysis and magnetic cell sorting.

생화학적/생리학적 작용

The erythropoietin receptor is a member of the cytokine receptor family. Upon erythropoietin binding, the erythropoietin receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis.The erythropoietin receptor is a member of the cytokine receptor family. Upon erythropoietin binding, the erythropoietin receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

서열

Synthetic peptide located within the following region: DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable