콘텐츠로 건너뛰기
Merck
모든 사진(4)

Key Documents

SAB2108302

Sigma-Aldrich

Anti-HNF1A antibody produced in rabbit

affinity isolated antibody

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

형태

buffered aqueous solution

분자량

67kDa

종 반응성

human, dog, mouse, guinea pig, horse, rat

농도

0.5 mg - 1 mg/mL

기술

immunoblotting: suitable
immunohistochemistry: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... HNF1A(6927)

일반 설명

Hepatocyte nuclear factor 1α (HNF1α) is a transcription factor that belongs to the liver enriched transcription factor family. It has a N-terminal dimerization domain (amino acids 1–32), a POU-homeobox DNA binding domain (amino acids 150-280) and a C-terminal transactivation domain (amino acids 281-631). HNF1A is located on human chromosome 12q24.

면역원

Synthetic peptide directed towards the N terminal region of human HNF1A

생화학적/생리학적 작용

HNF1A is required for the expression of several liver specific genes. HNF1A binds to the inverted palindrome 5′-GTTAATNATTAAC-3′.
Hepatocyte nuclear factor 1α (HNF1α) modulates hepatocyte functions. It plays an important role in the modulation of gene expression and replication of hepatitis B virus (HBV). HNF1α is involved in lipid metabolism, gluconeogenesis and deoxygenation of xenobiotics. It stimulates the expression of the preS1 mRNA to induce the production of LHBs (viral large surface protein). Mutations in hepatocyte nuclear factor-1A (HNF1A) results in maturity-onset diabetes of the young type 3 (MODY3).

서열

Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

p. Q511L mutation of HNF1? in hepatocellular carcinoma suppresses the transcriptional activity and the anti-tumor effect of HNF1α.
Ding CH, et al.
Biochemical and Biophysical Research Communications, 495(1), 86-91 (2018)
The HNF1A mutant Ala180Val: Clinical challenges in determining causality of a rare HNF1A variant in familial diabetes.
Sagen JV, et al.
Diabetes Research and Clinical Practice, 133, 142-149 (2017)
Hepatocyte nuclear factor 1α downregulates HBV gene expression and replication by activating the NF-κB signaling pathway.
Lin J, et al.
PLoS ONE, 12(3), e0174017-e0174017 (2017)
Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis.
Chasman DI, et al.
PLoS Genetics, 5(11), e1000730-e1000730 (2009)

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.