SAB2108496

Anti-VDAC1

IgG fraction of antiserum

• 동의어(들): Anti- VDAC-1, Anti-PORIN
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 31 kDa
• 종 반응성: sheep, human, guinea pig, dog, bovine, rabbit, horse, mouse, rat
• 농도: 0.5-1 mg/mL
• 기술: immunoblotting: suitable; immunohistochemistry: suitable
• 수납 번호(accession number): NM_003374
• UniProt 수납 번호: P21796
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... VDAC1(7416)

설명

일반 설명

The previously assigned protein identifier Q5FVE7 has been merged into P21796. Full details can be found on the UniProt database.

면역원

Synthetic peptide directed towards the C terminal region of human VDAC1

생화학적/생리학적 작용

The voltage-dependent anion-selective channel 1 (VDAC1) functions as a channel in membranous structures for the outer mitochondrial membrane, the cell membrane, endosomes, caveolae, the sarcoplasmatic reticulum, synaptosomes, and post-synaptic density fraction. A major function of VDAC1 in the plasma membrane is that of a NADH(-ferricyanide) reductase that may be involved in the maintenance of cellular redox homeostasis.

서열

Synthetic peptide located within the following region: SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable