콘텐츠로 건너뛰기
Merck
모든 사진(4)

주요 문서

WH0010013M1

Sigma-Aldrich

Monoclonal Anti-HDAC6 antibody produced in mouse

clone 1E2, purified immunoglobulin, buffered aqueous solution

동의어(들):

Anti-HD6, Anti-JM21, Anti-histone deacetylase 6

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

1E2, monoclonal

양식

buffered aqueous solution

종 반응성

human

기술

indirect ELISA: suitable
western blot: 1-5 μg/mL

동형

IgG1κ

GenBank 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... HDAC6(10013)

관련 카테고리

일반 설명

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription. (provided by RefSeq)

면역원

HDAC6 (NP_006035, 1128 a.a. ~ 1215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH

생화학적/생리학적 작용

Histone deacetylase 6 (HDAC6) deacetylates substrates like α-tubulin. It is involved in endocytosis and autophagy. HDAC6 functions in cellular mechanisms connected to cancer and modulates cell motility.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Histone deacetylase 6 inhibition enhances oncolytic viral replication in glioma.
Nakashima H
The Journal of Clinical Investigation, 125(11), 4269-4280 (2015)
HDAC6 activity is a non-oncogene addiction hub for inflammatory breast cancers.
Putcha P
Breast Cancer Research, 17(1), 149-149 (2015)
Down-regulation of deacetylase HDAC6 inhibits the melanoma cell line A375.S2 growth through ROS-dependent mitochondrial pathway.
Bai J
PLoS ONE, 10(3), e0121247-e0121247 (2015)
Linlin Zhang et al.
Cancer biology & therapy, 15(11), 1561-1570 (2014-12-09)
Neuroblastoma is one of the most prevalent pediatric extracranial solid tumors and is often diagnosed after dissemination has occurred. Despite recent advances in multimodal therapies of this malignancy, its therapeutic efficacy remains poor. Novel treatment strategies are thus in great

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.