콘텐츠로 건너뛰기
Merck
모든 사진(5)

주요 문서

WH0057167M3

Sigma-Aldrich

Monoclonal Anti-SALL4 antibody produced in mouse

clone 6E3, purified immunoglobulin, buffered aqueous solution

동의어(들):

Anti-DRRS, Anti-HSAL4, Anti-MGC133050, Anti-dJ1112F19.1, Anti-sal-like 4 (Drosophila)

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

6E3, monoclonal

양식

buffered aqueous solution

종 반응성

human, mouse, rat

기술

ELISA: suitable
capture ELISA: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL

동형

IgG1κ

GenBank 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... SALL4(57167)

일반 설명

Spalt like transcription factor 4 (SALL4) is encoded by the gene with four exons, mapped to human chromosome 20q13.13-q13.2. The encoded protein belongs to the spalt-like protein family. SALL4 is characterized with a multiple zinc finger (ZnF) domains including one N-terminal C2HC-type ZnF and seven C2H2-type ZnF domains. In vertebrates, SALL4 is abundantly expressed in both embryonic and adult stem/stem-like cells.
The protein encoded by this gene may be a zinc finger transcription factor. Defects in this gene are a cause of Duane-radial ray syndrome (DRRS). (provided by RefSeq)

면역원

SALL4 (NP_065169, 954 a.a. ~ 1053 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS

애플리케이션

Monoclonal Anti-SALL4 antibody produced in mouse has been used in immunohistochemical staining.

생화학적/생리학적 작용

Spalt like transcription factor 4 (SALL4) plays a crucial role in the regulation of cell stemness in biological development and tumor growth. Thus, this protein can be considered as a potent target for gene therapy. In addition, it also serves as a potential diagnostic marker for testicular germ cell tumors (GCTs). Polymorphisms in the gene are associated with the development of various diseases such as Duane-radial ray syndrome (DRRS, Okihiro syndrome), acro-renal-ocular syndrome (AROS), and SALL4-related Holt-Oram syndrome (HOS).

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

12 - Non Combustible Liquids

WGK

nwg

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Sall4 interacts with Nanog and co-occupies Nanog genomic sites in embryonic stem cells.
Wu Q, et al.
The Journal of Biological Chemistry, 24090-4 null
RNA-binding protein LIN28 is a marker for testicular germ cell tumors
Cao D, et al.
Human Pathology, 710-8 null
Multigene Deletions on Chromosome 20q13.13-q13.2 Including SALL4 Result in an Expanded Phenotype of Okihiro Syndrome Plus Developmental Delay.
Borozdin W, et al.
Human Mutation, 830 null
SALL4: engine of cell stemness
Xiong J.
Current gene therapy, 400-11 null
SALL4 Is a Novel Diagnostic Marker for Testicular Germ Cell Tumors
Cao D, et al.
American Journal of Surgical Pathology, 1065-77 null

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.