WH0064399M1

Monoclonal Anti-HHIP antibody produced in mouse

clone 5D11, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-FLJ20992, Anti-FLJ90230, Anti-HIP, Anti-hedgehog interacting protein
• MDL number: MFCD01094561
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 5D11, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: rat, human, mouse
• 기술: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2bκ
• GenBank 수납 번호: NM_022475
• UniProt 수납 번호: Q96QV1
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... HHIP(64399)

설명

일반 설명

This gene encodes a protein similar to the mouse hedgehog-interacting protein, a regulatory component of the hedgehog signalling pathway. Members of the hedgehog family are evolutionarily conserved proteins which are involved in many fundamental processes in embryonic development, including anteroposterior patterns of limbs and regulation of left-right asymmetry. (provided by RefSeq)

면역원

HHIP (NP_071920, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ

애플리케이션

Monoclonal Anti-HHIP antibody produced in mouse has been used in immnohistochemistry.

생화학적/생리학적 작용

The gene encoding HHIP (hedgehog interacting protein) is located on human chromosome 4, and encodes for a protein belonging to the hedgehog-interacting protein (HHIP) family. Hedgehog (HH) proteins are evolutionarily conserved proteins, and are important morphogens for a vast range of developmental processes, like regulation of left-right asymmetry and anteroposterior patterns of limbs during embryonic development. HH signals are regulated by numerous cell-surface receptors. HHIP encoded by this gene is highly conserved and interacts with all the three HH family members namely SHH (sonic hh), IHH (indian hh) and DHH (desert hh). It is also a vertebrate-specific inhibitor of HH signaling. Single nucleotide polymorphisms (SNPs) in HHIP gene is associated with increase in the risk of chronic obstructive pulmonary disease (COPD).

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)