AV45004

Anti-CRELD1 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-AVSD2, Anti-CIRRIN, Anti-Cysteine-rich with EGF-like domains 1, Anti-DKFZP566D213
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 45 kDa
• species reactivity: dog, guinea pig, bovine, horse, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_001070883
• UniProt accession no.: Q96HD1
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CRELD1(78987)

Description

General description

Cysteine-rich with EGF-like domains 1 (CRELD1), a highly conserved membrane bound extracellular protein that defines a new epidermal growth factor-related gene family, is a cell adhesion molecule associated with cardiac atrioventricular septal defects (AVSD) and congenital heart disease (CHD).

Specificity

Anti-CRELD1 polyclonal antibody detects canine, human, bovine, mouse, and and rat cysteine-rich with EGF-like domains 1 proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human CRELD1

Application

Anti-CRELD1 polyclonal antibody is used to tag cysteine-rich with EGF-like domains 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of cysteine-rich with EGF-like domains 1 in cardiac diseases such as AVSD and CDH.

Biochem/physiol Actions

Epidermal growth factor (EGF; MIM 131530)-like repeats are a class of cysteine-rich domains that mediate interactions between proteins of diverse function. EGF domains are found in proteins that are either completely secreted or have transmembrane regions that tether the protein to the cell surface. CRELD1 is the founding member of a family of matricellular proteins.

Sequence

Synthetic peptide located within the following region: TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable