Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

HPA046952

Sigma-Aldrich

Anti-DDX60 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 60, Anti-FLJ20035

Sign Into View Organizational & Contract Pricing
All Photos(2)

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
HPA046952
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

PKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRV

UniProt accession no.

Q8IY21

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DDX60(55601)

General description

DEXD/H box helicase 60 (DDX60) is an interferon-inducible cytoplasmic helicase. DDX60,also called FLJ20035 is identified as an IFN-inducible gene in human dendritic cells following viral infection. DDX60 is located on human chromosome 4q32.3.

Immunogen

DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 recombinant protein epitope signature tag (PrEST)

Application

Anti DDX60 antibodies may be used to detect DDX60 in HepG2-NTCP cells stimulated with IFN-γ using western blotting.

Biochem/physiol Actions

DEXD/H box helicase 60 (DDX60) helps in RIG-I activation as well as viral RNA degradation. Both mechanisms are necessary for antiviral innate immune responses. DDX60 is used as a novel biomarker for tumorigenesis and diagnosis of oral squamous cell carcinoma (OSCC) specific to subsites such as buccal mucosal, lip and tongue.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST79750

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Subsite-specific association of DEAD box RNA helicase DDX60 with the development and prognosis of oral squamous cell carcinoma
Fu, Ting-, et al.
Oncotarget, 7(51), 85097-85097 (2016)
Extracellular vesicles including exosomes regulate innate immune responses to hepatitis B virus infection
Kouwaki,, et al.
Frontiers in Immunology, 7, 335-335 (2016)
DDX60 is involved in RIG-I-dependent and independent antiviral responses, and its function is attenuated by virus-induced EGFR activation
Oshiumi,, et al.
Testing, 11(8), 1193-1207 (2015)
Nina Geng et al.
Biomedicines, 10(12) (2022-12-24)
Immune checkpoint blockade (ICB) therapies induce durable responses in approximately 15% of colorectal cancer (CRC) patients who exhibit microsatellite instability-high (MSI-H) or deficient mismatch repair (dMMR). However, more than 80% of CRC patients do not respond to current immunotherapy. The
Genome-wide expression profiling of human lymphoblastoid cell lines identifies CHL1 as a putative SSRI antidepressant response biomarker
Morag, Ay, et al.
Pharmacogenomics, 12(2), 171-184 (2011)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service