MilliporeSigma
All Photos(2)

Documents

SAB1403875

Sigma-Aldrich

Monoclonal Anti-GNRH1, (C-terminal) antibody produced in mouse

clone 1C2, ascites fluid

Sign Into View Organizational & Contract Pricing

Synonym(s):
GNRH, GRH, LHRH, LNRH
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

ascites fluid

antibody product type

primary antibodies

clone

1C2, monoclonal

mol wt

antigen ~33.7 kDa

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgMκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GNRH1(2796)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
SAB1402212SAB1408581AB1567
antibody form

ascites fluid

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

antibody form

serum

biological source

mouse

biological source

mouse

biological source

rabbit

biological source

rabbit

clone

1C2, monoclonal

clone

4H3, monoclonal

clone

polyclonal

clone

polyclonal

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

conjugate

-

species reactivity

human

species reactivity

human

species reactivity

human

species reactivity

sheep, mouse, chicken, fish, human, rat, rabbit

Still not finding the right product?  

Give our Product Selector Tool a try.

Immunogen

GNRH1 (NP_000816, 24 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI

Physical form

Clear solution

Storage Class

11 - Combustible Solids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service